Learn More
Invitrogen™ Human UGP2 (aa 326-423) Control Fragment Recombinant Protein
Recombinant Protein
Brand: Invitrogen™ RP103827
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84672 (PA5-84672. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The enzyme encoded by this gene is an important intermediary in mammalian carbohydrate interconversions. It transfers a glucose moiety from glucose-1-phosphate to MgUTP and forms UDP-glucose and MgPPi. In liver and muscle tissue, UDP-glucose is a direct precursor of glycogen; in lactating mammary gland it is converted to UDP-galactose which is then converted to lactose. The eukaryotic enzyme has no significant sequence similarity to the prokaryotic enzyme. Two transcript variants encoding different isoforms have been found for this gene.
Specifications
Q16851 | |
Blocking Assay, Control | |
7360 | |
100 ÎĽL | |
pHC379; testis tissue sperm-binding protein Li 58 p; UDPG; UDP-glucose diphosphorylase; UDP-glucose pyrophosphorylase; UDP-glucose pyrophosphorylase 1; UDP-glucose pyrophosphorylase 2; UDPGP; UDPGP2; UGP1; Ugp2; UGPase; UGPase 2; UGPP1; UGPP2; uridindiphosphoglucosepyrophosphorylase 2; uridyl diphosphate glucose pyrophosphorylase 2; Uridyl diphosphate glucose pyrophosphorylase-1; UTP-glucose-1-phosphate uridyltransferase; UTP--glucose-1-phosphate uridylyltransferase; UTP--glucose-1-phosphate uridylyltransferase 2 | |
UGP2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human UGP2 (aa 326-423) Control Fragment | |
RUO | |
UGP2 | |
Unconjugated | |
Recombinant | |
IFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKRE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.