missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ZIC4 Partial ORF (NP_115529, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Description
This gene encodes a member of the ZIC family of C2H2-type zinc finger proteins. Members of this family are important during development, and have been associated with X-linked visceral heterotaxy and holoprosencephaly type 5. This gene is closely linked to the gene encoding zinc finger protein of the cerebellum 1, a related family member on chromosome 3. This gene encodes a protein of unknown function. [provided by RefSeq]
Sequence: MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA
Specifications
Specifications
Accession Number | NP_115529 |
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 84107 |
Molecular Weight (g/mol) | 35.64kDa |
Name | ZIC4 (Human) Recombinant Protein (Q02) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
Quantity | 25 μg |
Immunogen | MRYKTSLVMRKRLRLYRNTLKESSSSSGHHGPQLTAASSPSVFPGLHEEPPQASPSRPLNGLLRLGLPGDMYARPEPFPPGPAARSDALA |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human ZIC4 Partial ORF (NP_115529, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal >
Spot an opportunity for improvement?Share a Content Correction