missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF197 Partial ORF (NP_001020026.1, 161 a.a. - 267 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010168-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16162026

  • 6150.00 SEK / 25µg
Estimated Shipment: 07-07-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene product belongs to the zinc finger protein superfamily, members of which are regulatory proteins characterized by nucleic acid-binding zinc finger domains. The encoded protein contains 20 tandemly arrayed C2H2-type zinc fingers, a Kruppel-associated box (KRAB) domain, and a SCAN box. This transcript turns over rapidly and contains 3' UTR AUUUA motifs, which are often a hallmark of rapid turnover. It is overexpressed in some thyroid papillary carcinomas. This gene is located in a cluster of zinc finger genes at 3p21. Two alternatively spliced transcripts encoding different isoforms have been described. [provided by RefSeq]

Sequence: IAAEICPHPPTDLVAFNLQDPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRALYWDVMLENYGNVTSLGYRKYRRQRNK
Specifications

Specifications

NP_001020026.1
Liquid
10168
ZNF197 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
D3S1363E/P18/VHLaK/ZKSCAN9/ZNF166/ZNF20
ZNF197
Yes
wheat germ expression system
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.51kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
IAAEICPHPPTDLVAFNLQDPQHDSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRALYWDVMLENYGNVTSLGYRKYRRQRNK
RUO
ZNF197
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates
Special Offers

Special Offers