missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ZNF238 Partial ORF (NP_991331.1, 182 a.a. - 281 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00010472-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16182596

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-12-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

C2H2-type zinc finger proteins, such as ZNF238, act on the molecular level as transcriptional activators or repressors and are involved in chromatin assembly.[supplied by OMIM]

Sequence: KRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQV
Specifications

Specifications

NP_991331.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
KRDLAAEPGNMWMRLPSDSAGIPQAGGEAEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSGVENLNSSYFSSQDVLRSNLVQV
RUO
ZNF238
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
10472
ZNF238 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
C2H2-171/RP58/TAZ-1/ZBTB18
ZNF238
Yes
Videos
SDS
Documents
Certificates