missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ JAG1 (Human) Recombinant Protein (Q01)

Human JAG1 partial ORF with GST-tag at N-terminal

4630.00 SEK - 7020.00 SEK

Specifications

Accession Number	NP_000205
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Gene ID (Entrez)	182
Molecular Weight (g/mol)	35.64

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16003605 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00000182-Q01.10ug	10 μg	4630.00 SEK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

16013605 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00000182-Q01.25ug	25 μg	7020.00 SEK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter a human homolog of the Drosophilia jagged receptor notch. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

Theoretical MW: 35.64kDa
Preparation Method: In vitro wheat germ expression system
Purification: Glutathione Sepharose 4 Fast Flow
Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer

Best use within three months from the date of receipt of this protein

Enzyme Linked Immunosorbent Assay, Western Blotting, Antibody Production, Protein Array

Specifications

Accession Number	NP_000205
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	35.64
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	JAG1
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	182
Name	JAG1 (Human) Recombinant Protein (Q01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Immunogen	PNPCQNGAQCYNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCGPHGKCKSQSGGKFTCDCNKG
Gene Alias	AGS/AHD/AWS/CD339/HJ1/JAGL1/MGC104644
Gene Symbol	JAG1
Species	Wheat Germ (in vitro)
Protein Tag	GST

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ JAG1 (Human) Recombinant Protein (Q01)

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ JAG1 (Human) Recombinant Protein (Q01)

Specifications

Description

Specifications

Documents