missing translation for 'onlineSavingsMsg'
Learn More

KIAA0186 Recombinant Protein, Abnova

Brand: Abnova H00009837-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16184162

Estimated Shipment: 14-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH12542.1
Format	Solution
Gene ID (Entrez)	9837
Name	GINS1 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	GINS1
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight	47.3
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
Gene Alias	KIAA0186/PSF1
Gene Symbol	GINS1
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description