missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ KIAA1967 Recombinant Protein

Name: Abnova&trade; KIAA1967 Recombinant Protein
Brand: Abnova&trade;
SKU: 16142993
Price: 4515.00 EUR

Recombinant protein for KIAA1967 gene

Brand: Abnova™ H00057805-P01.10ug

Additional Details : Weight : 0.00010kg

View more versions of this product

Product Code. 16142993

4515.00 SEK / 10µg

Estimated Shipment: 23-05-2024
to see stock.

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Human KIAA1967 full-length ORF ( AAH18269, 5 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal
Theoretical molecular weight: 65.45kDa
Preparation: in vitro wheat germ expression system
Purification: glutathione sepharose 4 fast flow
Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: LPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVV TQNICQYRSLQYSRQEGLDGGLPEEVLFGNLDLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKLEESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQLEIQRVVEKADSWVEKEEPAPSN

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Specifications

Accession Number	AAH18269
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight (g/mol)	65.45
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	10 ug
Immunogen	LPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVVTQNICQYRSLQYSRQEGLDGGLPEEVLFGNLDLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKLEESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQLEIQRVVEKADSWVEKEEPAPSN
Gene Alias	DBC-1/DBC1
Gene Symbol	KIAA1967
Species	Wheat Germ (in vitro)
Protein Tag	GST

For Use With (Application)	Antibody Production, Protein Array, ELISA, Western Blot
Gene ID (Entrez)	57805
Name	KIAA1967 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	KIAA1967
Cross Reactivity	Human
Recombinant	Recombinant
Form	Solution

Product Suggestions

Abnova™ KIAA1967 Recombinant Protein

Description

Specifications

Product Suggestions

Documents

Special Offers