missing translation for 'onlineSavingsMsg'
Learn More

KIAA1967 Recombinant Protein, Abnova

Recombinant protein for KIAA1967 gene

3860.70 SEK - 5854.80 SEK

Specifications

Cross Reactivity Human
Format Solution
Formulation 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
For Use With (Application) Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Molecular Weight 65.45
View More Specs

Products 2
Product Code Brand Quantity Price Quantity & Availability  
Product Code Brand Quantity Price Quantity & Availability  
16142993
View Documents Promotion Details
Abnova
H00057805-P01.10UG
10 ug
3860.70 SEK
10µg
View alternative products
Save Up to 
»
Estimated Shipment: 07-03-2022
Please to purchase this item. Need a web account? Register with us today!
16152993
View Documents Promotion Details
Abnova
H00057805-P01.25UG
25 ug
5854.80 SEK
25µg
View alternative products
Save Up to 
»
Estimated Shipment: 07-03-2022
Please to purchase this item. Need a web account? Register with us today!
Description

Description

  • Human KIAA1967 full-length ORF ( AAH18269, 5 a.a. - 365 a.a.) recombinant protein with GST-tag at N-terminal
  • Theoretical molecular weight: 65.45kDa
  • Preparation: in vitro wheat germ expression system
  • Purification: glutathione sepharose 4 fast flow
  • Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: LPEKVVSPPEPEKEEAAKEEATKEEEAIKEEVVKEPKDEAQNEGPATESEAPLKEDGLLPKPLSSGGEEEEKPRGEASEDLCEMALDPELLLLRDDGEEEFAGAKLEDSEVRSVASNQSEMEFSSLQDMPKELDPSAVLPLDCLLAFVFFDANWCGYLHRRDLERILLTLGIRLSAEQAKQLVSRVV TQNICQYRSLQYSRQEGLDGGLPEEVLFGNLDLLPPPGKSTKPGAAPTEHKALVSHNGSLINVGSLLQRAEQQDSGRLYLENKIHTLELKLEESHNRFSATEVTNKTLAAEMQELRVRLAEAEETARTAERQKSQLQRLLQELRRRLTPLQLEIQRVVEKADSWVEKEEPAPSN

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array

Specifications

Specifications

Human
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
65.45
8
Glutathione Sepharose 4 Fast Flow
Yes
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Solution
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
KIAA1967 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
SDS
Product Certifications