missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ LAMC1 (Human) Recombinant Protein

Human LAMC1 full-length ORF ( AAH15586, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00003915-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16137311

  • 6150.00 SEK / 25µg
Estimated Shipment: 30-09-2022
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
Specifications

Specifications

AAH15586
laminin, gamma 1 (formerly LAMB2)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LAMC1
GST
3915
Wheat germ expression system
25 μg
LAMB2, MGC87297
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers