Learn More
Abnova™ LOC124220 Recombinant Protein
Recombinant protein for LOC124220 (human) gene
Brand: Abnova™ H00124220-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Human LOC124220 full-length ORF ( AAH09722, 18 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal
- Theoretical molecular weight: 42.79kDa
- Preparation: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: KMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Specifications
AAH09722 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
43.2 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
KMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR | |
HRPE773/PRO1567 | |
LOC124220 | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
124220 | |
LOC124220 (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
LOC124220 | |
Human | |
Recombinant | |
Solution |