missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ LOC124220 Recombinant Protein
Click to view available options
Quantity:
10 μg
25 μg
Unit Size:
10µg
25µg
Description
- Human LOC124220 full-length ORF ( AAH09722, 18 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal
- Theoretical molecular weight: 42.79kDa
- Preparation: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: KMYGPGGGKYFSTTEDYDHEITGLRVSVGLLLVKSVQVKLGDSWDVKLGALGGNTQEVTLQPGEYITKVFVAFQAFLRGMVMYTSKDRYFYFGKLDGQISSAYPSQEGQVLVGIYGQYQLLGIKSIGFEWNYPLEEPTTEPPVNLTYSANSPVGR
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Specifications
Specifications
Accession Number | AAH09722 |
For Use With (Application) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 124220 |
Molecular Weight (g/mol) | 43.2 |
Name | LOC124220 (Human) Recombinant Protein (P01) |
pH Range | 8 |
Preparation Method | In vitro wheat germ expression system |
Purification Method | Glutathione Sepharose 4 Fast Flow |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Show More |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ LOC124220 Recombinant Protein >
Spot an opportunity for improvement?Share a Content Correction