missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
MEK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-87790
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
MEK1 Polyclonal antibody specifically detects MEK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).
Specifikationer
| MEK1 | |
| Polyclonal | |
| Western Blot 0.04 - 0.4 μg/mL, Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| dual specificity mitogen-activated protein kinase kinase 1, ERK activator kinase 1, MAP kinase kinase 1, MAPK/ERK kinase 1, MAPKK1, MEK1MAPKK 1, mitogen-activated protein kinase kinase 1, MKK1MEK 1, PRKMK1EC 2.7.12.2, protein kinase, mitogen-activated, kinase 1 (MAP kinase kinase 1) | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| MAP2K1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ | |
| 0.1 mL | |
| Angiogenesis, Autophagy, Cancer, MAP Kinase Signaling, Protein Phosphatase, Signal Transduction, Tyrosine Kinases | |
| 5604 | |
| Human, Rat | |
| IgG |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering