missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
MEK1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
2890.00 SEK - 4340.00 SEK
Specifikationer
| Antigen | MEK1 |
|---|---|
| Användningsområden | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Värd art | Rabbit |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18473632
|
Novus Biologicals
NBP1-87790-25ul |
25 μL |
2890.00 SEK
25µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
|
18285168
|
Novus Biologicals
NBP1-87790 |
0.1 mL |
4340.00 SEK
0.10ml |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
MEK1 Polyclonal antibody specifically detects MEK1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin).Specifikationer
| MEK1 | |
| Polyclonal | |
| Rabbit | |
| Angiogenesis, Autophagy, Cancer, MAP Kinase Signaling, Protein Phosphatase, Signal Transduction, Tyrosine Kinases | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5604 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human, Rat | |
| dual specificity mitogen-activated protein kinase kinase 1, ERK activator kinase 1, MAP kinase kinase 1, MAPK/ERK kinase 1, MAPKK1, MEK1MAPKK 1, mitogen-activated protein kinase kinase 1, MKK1MEK 1, PRKMK1EC 2.7.12.2, protein kinase, mitogen-activated, kinase 1 (MAP kinase kinase 1) | |
| MAP2K1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel