missing translation for 'onlineSavingsMsg'
Learn More

MRPS12 Recombinant Protein, Abnova

Brand: Abnova H00006183-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16130332

Estimated Shipment: 02-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Specifications

Accession Number	AAH01617
Format	Solution
Gene ID (Entrez)	6183
Name	MRPS12 (Human) Recombinant Protein (P01)
Preparation Method	In vitro wheat germ expression system
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Source	Wheat Germ (in vitro)
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Common Name	MRPS12
Cross Reactivity	Human
Recombinant	Yes

For Use With (Application)	Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
Formulation	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Molecular Weight	40.92
pH Range	8
Purification Method	Glutathione Sepharose 4 Fast Flow
Quantity	25 ug
Immunogen	MSWSGLLHGLNTSLTCGPALVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKYDCGHVQKK
Gene Alias	MPR-S12/MT-RPS12/RPMS12/RPS12/RPSM12
Gene Symbol	MRPS12
Host Species	Wheat Germ (in vitro)
Protein Tag	GST

Description