missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NAP1L1 (Human) Recombinant Protein

Human NAP1L1 full-length ORF ( AAH02387, 1 a.a. - 391 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00004673-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16121655

Estimated Shipment: 20-01-2022

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ

Specifications

Accession Number	AAH02387
Name	nucleosome assembly protein 1-like 1
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	NAP1L1
Protein Tag	GST

Gene ID (Entrez)	4673
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	FLJ16112, MGC23410, MGC8688, NAP1, NAP1L, NRP
Host Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description