missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ NAP1L1 (Human) Recombinant Protein

Human NAP1L1 full-length ORF ( AAH02387, 1 a.a. - 391 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00004673-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16121655

  • 5854.80 SEK / 25µg
Estimated Shipment: 20-01-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEEDEISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPMSFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDDDDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
Specifications

Specifications

AAH02387
nucleosome assembly protein 1-like 1
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
NAP1L1
GST
4673
Wheat germ expression system
25 μg
FLJ16112, MGC23410, MGC8688, NAP1, NAP1L, NRP
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents
Certificates
Special Offers

Special Offers