missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NGB Recombinant Protein
3970.00 SEK - 6025.00 SEK
Specifications
Accession Number | AAH32509 |
---|---|
For Use With (Application) | Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) |
Format | Solution |
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Gene ID (Entrez) | 58157 |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16133033
|
Abnova™
H00058157-P01.10UG |
10 ug |
3970.00 SEK
10µg |
Estimated Shipment: 04-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
16143033
|
Abnova™
H00058157-P01.25UG |
25 ug |
6025.00 SEK
25µg |
Estimated Shipment: 04-05-2023 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! |
Description
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Specifications
AAH32509 | |
Solution | |
58157 | |
NGB (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MERPEPELIRQSWRAVSRSPLGHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDGE | |
NGB | |
Human | |
Yes |
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
42.35 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
NGB | |
Wheat Germ (in vitro) | |
GST |