Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants encoding the same isoform have been found for this gene. Co-transcription of this gene and the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) which encode a fusion protein comprised of sequence sharing identity with each individual gene product.

• Human NME2 full-length ORF ( AAH02476, 1 a.a. - 152 a.a.) recombinant protein with GST-tag at N-terminal
• Gene description: protein (NM23B) expressed in non-metastatic cells 2
• Theoretical molecular weight: 42.46kDa
• Preparation method: in vitro wheat germ expression system
• Purification: glutathione sepharose 4 fast flow
• Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer

Sequence: MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE

Best use within three months from the date of receipt.

ELISA, western blotting (recombinant protein), antibody production, protein array