missing translation for 'onlineSavingsMsg'
Learn More

OR51S1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-09864-25UL

Product Code. 18321484

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

OR51S1 Polyclonal specifically detects OR51S1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	OR51S1
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	olfactory receptor 51S1, Olfactory receptor OR11-24, olfactory receptor, family 51, subfamily S, member 1, OR11-24
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Human OR51S1 (NP_001004758). Peptide sequence LDPLLIFFSYGLIGKVLQGVESREDRWKAGQTCAAHLSAVLLFYIPMILL
Quantity	25 μg
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	119692
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description