missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ Pepsinogen C/PGC/Progastricsin Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Brand: Novus Biologicals™ NBP1-91011PEP
This item is not returnable.
View return policy
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGC. The Pepsinogen C/PGC/Progastricsin Recombinant Protein Antigen is derived from E. coli. The Pepsinogen C/PGC/Progastricsin Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.This is a blocking peptide for NBP1-91011. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.
Specifications
5225 | |
Chromatography | |
0.5mg/mL | |
PBS and 1M Urea, pH 7.4. | |
PGC | |
27kDa | |
0.1mL | |
E.Coli | |
IQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQI |
Human | |
>80% | |
Store at -20°C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
Unlabeled | |
Pepsinogen C/PGC/Progastricsin | |
RUO | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-91011. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
For Research Use Only