missing translation for 'onlineSavingsMsg'
Learn More

PER3 Rabbit anti-Human, Mouse, Rat, Clone: 9I3I6, Novus Biologicals™

Rabbit Monoclonal Antibody

Brand: Bio-Techne NBP3-16094-20UL

Product Code. 18322745

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

PER3 Monoclonal antibody specifically detects PER3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunofluorescence

Specifications

Applications	Western Blot, Immunofluorescence
Clone	9I3I6
Dilution	Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200
Gene Alias	Cell growth-inhibiting gene 13 protein, Circadian clock protein PERIOD 3, GIG13, growth-inhibiting protein 13, hPER3, period (Drosophila) homolog 3, period 3, period circadian protein 3, period circadian protein homolog 3, period homolog 3 (Drosophila)
Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 10-100 of human PER3 (P56645). GRRGAKDEALGEESGERWSPEFHLQRKLADSSHSEQQDRNRVSEELIMVVQEMKKYFPSERRNKPSTLDALNYALRCVHSVQANSEFFQIL
Quantity	20 μg
Research Discipline	Cardiovascular Biology, Endocrinology
Gene ID (Entrez)	8863
Content And Storage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description