missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PSMD8 (Human) Recombinant Protein

Human PSMD8 full-length ORF ( NP_002803, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

Brand:  Abnova™ H00005714-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16133675

  • 6025.00 SEK / 25µg
Estimated Shipment: 08-03-2023
to see stock.

Please to purchase this item. Need a web account? Register with us today!


Description

Description

  • Sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
Specifications

Specifications

NP_002803
proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
PSMD8
GST
5714
Wheat germ expression system
25 μg
HIP6, HYPF, MGC1660, Nin1p, Rpn12, S14, p31
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documents

Documents

Certificates
Special Offers

Special Offers