missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ PSMD8 (Human) Recombinant Protein

Human PSMD8 full-length ORF ( NP_002803, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.

Brand: Abnova™ H00005714-P01.25ug

Additional Details : Weight : 0.00010kg

Product Code. 16133675

Estimated Shipment: 06-12-2021

Please sign in to purchase this item. Need a web account? Register with us today!

Description

Sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV

Specifications

Accession Number	NP_002803
Name	proteasome (prosome, macropain) 26S subunit, non-ATPase, 8
Quality Control Testing	125% SDS-PAGE Stained with Coomassie Blue
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Symbol	PSMD8
Protein Tag	GST

Gene ID (Entrez)	5714
Preparation Method	Wheat germ expression system
Quantity	25 μg
Gene Alias	HIP6, HYPF, MGC1660, Nin1p, Rpn12, S14, p31
Host Species	Wheat Germ (in vitro)
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Description