missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ PSMD8 (Human) Recombinant Protein
Human PSMD8 full-length ORF ( NP_002803, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.
Brand: Abnova™ H00005714-P01.25ug
Additional Details : Weight : 0.00010kg
Description
- Sequence: MYEQLKGEWNRKSPNLSKCGEELGRLKLVLLELNFLPTTGTKLTKQQLILARDILEIGAQWSILRKDIPSFERYMAQLKCYYFDYKEQLPESAYMHQLLGLNLLFLLSQNRVAEFHTELERLPAKDIQTNVYIKHPVSLEQYLMEGSYNKVFLAKGNIPAESYTFFIDILLDTIRDEIAGCIEKAYEKILFTEATRILFFNTPKKMTDYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
Specifications
| NP_002803 | |
| proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| PSMD8 | |
| GST |
| 5714 | |
| Wheat germ expression system | |
| 25 μg | |
| HIP6, HYPF, MGC1660, Nin1p, Rpn12, S14, p31 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |