missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein
A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.
Brand: enQuireBio™ QP12178-B-500ug
Additional Details : Weight : 0.01000kg
Specifications
| Hepatitis C HCV NS4 a+b Protein | |
| 500 μg | |
| Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
| Hepatitis C | |
| Biotin | |
| (1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea. |
| HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining). | |
| Research Use Only | |
| Recombinant Protein | |
| E. coli | |
| 1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863 |