missing translation for 'onlineSavingsMsg'
Learn More
enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein Product Code.: 15959608
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein

Product Code. 15959608
500 μg, 500µg
Click to view available options
Quantity:
1 mg
100 μg
500 μg
Unit Size:
100µg
1mg
500µg
This item is not returnable. View return policy

Product Code. 15959608

Brand: enQuireBio™ QP12178B500ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A cDNA sequence encoding the HCV NS4 a+b was constructed and used to recombinantly synthesize the protein.

Specifications

Name Hepatitis C HCV NS4 a+b Protein
Quantity 500 μg
Regulatory Status Research Use Only
Endotoxin Concentration Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type Recombinant Protein
Cross Reactivity Hepatitis C
Species E. coli
Protein Tag Biotin
Sequence 1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863
Buffer (1 mg/ml) 20mM Tris-HCl pH 8 and 8M urea.
Purity or Quality Grade HCV NS4 a+b Biotin protein is >95% pure as determined by 10% PAGE (coomassie staining).
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
enQuireBio™ Recombinant Hepatitis C HCV NS4 a+b Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.