missing translation for 'onlineSavingsMsg'
Learn More
enQuireBio™ Recombinant HIV-1 gp41 Long Protein Product Code.: 15959828
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant HIV-1 gp41 Long Protein

enQuireBio™ Recombinant HIV-1 gp41 Long Protein

Product Code. 15959828
100 μg, 100µg
Click to view available options
Quantity:
1 mg
100 μg
500 μg
Unit Size:
100µg
1mg
500µg
This item is not returnable. View return policy

Product Code. 15959828

Brand: enQuireBio™ QP12250EC100ug

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A cDNA sequence encoding the HIV-1 gp41 Long was constructed and used to recombinantly synthesize the protein.

Specifications

Name HIV-1 gp41 Long Protein
Quantity 100 μg
Regulatory Status Research Use Only
Endotoxin Concentration Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type Recombinant Protein
Cross Reactivity HIV
Species E. coli
Protein Tag Untagged
Sequence IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
Buffer 8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Purity or Quality Grade Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
enQuireBio™ Recombinant HIV-1 gp41 Long Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.