missing translation for 'onlineSavingsMsg'
Learn More
enQuireBio™ Recombinant Rabbit MMP 9 Protein Product Code.: 15961289
  1. Home
  2. Products
  3. Recombinant Proteins
  4. enQuireBio™ Recombinant Rabbit MMP 9 Protein

enQuireBio™ Recombinant Rabbit MMP 9 Protein

Product Code. 15961289
100 μg, 100µg
Click to view available options
Quantity:
10 μg
100 μg
2 μg
Unit Size:
100µg
10µg
2µg
This item is not returnable. View return policy

Product Code. 15961289

Brand: enQuireBio™ QP127070.1mg

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

A cDNA sequence encoding the MMP 9 was constructed and used to recombinantly synthesize the protein.

Specifications

Gene ID (Entrez) 100008993
Name MMP 9 Protein
Quantity 100 μg
Regulatory Status Research Use Only
Endotoxin Concentration Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Gene Symbol MMP9
Product Type Recombinant Protein
Cross Reactivity Rabbit
Species Baculovirus
Protein Tag His
Sequence APRRRQPTLVVFPGELRTRLTDRQLAEEYLFRYGYTRVASMHGDSQSLRLPLLLLQKHLSLPETGELDNATLEAMRAPRCGVPDVGKFQTFEGDLKWHHHNITYWIQNYSEDLPRDVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDEELWSLGKGVVVPTYFGNADGAPCHFPFTFEGRSYTACTTDGRSDGMAWCSTTADYDTDRRFGFCPSERLYTQDGNADGKPCEFPFIFQGRTYSACTTDGRSDGHRWCATTASYDKDKLYGFCPTRADSTVVGGNSAGELCVFPFVFLGKEYSSCTSEGRRDGRLWCATTSNFDSDKKWGFCPDKGYSLFLVAAHEFGHALGLDHSSVPERLMYPMYRYLEGSPLHEDDVRGIQHLYGPNPNPQPPATTTPEPQPTAPPTACPTWPATVRPSEHPTTSPTGAPSAGPTGPPTASPSAAPTASLDPAEDVCNVNVFDAIAEIGNKLHVFKDGRYWRFSEGSGRRPQGPFLIADTWPALPAKLDSAFEEPLTKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGPEVPHVTGALPRAGGKVLLFGAQRFWRFDVKTQTVDSRSGAPVDQMFPGVPLNTHDVFQYREKAYFCQDRFFWRVSTRNEVNLVDQVGYVSFDILHCPEDENLYFQGLEEQKLISEEDLNSAVDHHHHHH
Buffer The MMP-9 solution (0.3 mg/ml) contains 50mM Tris, 150mM NaCl, 10% Glycerol, pH 7.5.
Purity or Quality Grade Greater than 85.0% as determined by SDS-PAGE.
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
enQuireBio™ Recombinant Rabbit MMP 9 Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.