Learn More
Abnova™ SLC25A3 Recombinant Protein
Recombinant protein for SLC25A3 (human) gene
4515.00 SEK - 6845.00 SEK
Specifications
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
---|---|
Formulation | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
Molecular Weight (g/mol) | 65.4 |
pH Range | 8 |
Preparation Method | In vitro wheat germ expression system |
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
16179021
|
Abnova™
H00005250-P01.10UG |
10 ug |
4515.00 SEK
10µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
16189021
|
Abnova™
H00005250-P01.25UG |
25μg |
6845.00 SEK
25µg |
Estimated Shipment: 23-05-2024 Log in to see stock. |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||
Description
The encoded protein catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. It contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family.
- Human SLC25A3 full-length ORF ( AAH00998, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal
- Description: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3
- Theoretical molecular weight: 65.45kDa
- Preparation method: in vitro wheat germ expression system
- Purification: glutathione sepharose 4 fast flow
- Storage buffer: 50mM Tris-HCI, 10mM reduced glutathione, pH: 8.0 in elution buffer
Sequence: MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPME AAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERTVEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLTQ
Best use within three months from the date of receipt.
ELISA, western blotting (recombinant protein), antibody production, protein array
Specifications
Antibody Production, ELISA, Protein Array, Western Blot | |
65.4 | |
In vitro wheat germ expression system | |
Wheat Germ (in vitro) | |
Recombinant |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
Human | |
Solution |