missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
TCEAL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17943-100UL
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
TCEAL1 Polyclonal antibody specifically detects TCEAL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifikationer
| TCEAL1 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Nuclear phosphoprotein p21/SIIR, p21, pp21, SIIRTCEA-like protein 1, transcription elongation factor A (SII)-like 1, transcription elongation factor A protein-like 1, Transcription elongation factor S-II protein-like 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE | |
| 100 μg | |
| DNA replication Transcription Translation and Splicing | |
| 9338 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering