missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
TCEAL1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4665.00 SEK - 7005.00 SEK
Specifikationer
| Antigen | TCEAL1 |
|---|---|
| Utspädning | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Användningsområden | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Klassificering | Polyclonal |
| Konjugera | Unconjugated |
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|---|---|---|---|---|---|---|---|---|---|
| Produktkod | Brand | Kvantitet | Pris | Kvantitet och tillgänglighet | |||||
|
18306766
|
Novus Biologicals
NBP3-17943-25UL |
25 μg |
4665.00 SEK
25µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
|
18321345
|
Novus Biologicals
NBP3-17943-100UL |
100 μg |
7005.00 SEK
100µL |
Vänligen Logga in för att beställa denna produkten. Behöver du ett Webbkonto? Registrera ditt konto idag! | |||||
Beskrivning
TCEAL1 Polyclonal antibody specifically detects TCEAL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifikationer
| TCEAL1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS, pH 7.2, 40% glycerol | |
| 9338 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Nuclear phosphoprotein p21/SIIR, p21, pp21, SIIRTCEA-like protein 1, transcription elongation factor A (SII)-like 1, transcription elongation factor A protein-like 1, Transcription elongation factor S-II protein-like 1 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MDKPRKENEEEPQSAPKTDEERPPVEHSPEKQSPEEQSSEEQSSE | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel