missing translation for 'onlineSavingsMsg'
Läs mer
Läs mer
VSX1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-10435-100UL
Denna artikel kan inte returneras.
Se returpolicy
Beskrivning
VSX1 Polyclonal specifically detects VSX1 in Mouse samples. It is validated for Western Blot.
Specifikationer
| VSX1 | |
| Polyclonal | |
| Western Blot 1.0 ug/ml | |
| CAASDS, KTCN, KTCN1, PPCD, PPD, RINX, VSX1 visual system homeobox 1 | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse VSX1 (NP_473409). Peptide sequence TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV | |
| 100 μg | |
| Primary | |
| Mouse | |
| Purified |
| Western Blot | |
| Unconjugated | |
| PBS buffer, 2% sucrose | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 30813 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Korrigering av produktinnehåll
Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.
Produkttitel
Hittar du en möjlighet till förbättring?Dela en innehållskorrigering