missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ XRCC5 (Human) Recombinant Protein (P01)

Human Recombinant Protein

Brand:  Abnova™ H00007520-P01.2ug

Additional Details : Weight : 0.00010kg

Product Code. 16151912

  • 2641.80 SEK / 2µg
Estimated Shipment: 16-03-2022

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Human XRCC5 full-length ORF ( AAH19027.1, 1 a.a. - 732 a.a.) recombinant protein with GST-tag at N-terminal.
Specifications

Specifications

AAH19027.1
Antibody Production,Array,ELISA,Western Blot
7520
12.5% SDS-PAGE Stained with Coomassie Blue
Wheat Germ (in vitro)
FLJ39089,KARP-1,KARP1,KU80,KUB2,Ku86,NFIV
Recombinant
Human
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in. the elution buffer
X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining)
2 µg
Store at -80°C Aliquot to avoid repeated freezing and thawing
XRCC5
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Videos
SDS
Documents
Certificates
Special Offers

Special Offers