Alla primära antikroppar
Primära antikroppar, immunglobuliner som binder till specifika proteiner eller andra biomolekyler, används i många forskningsapplikationer och protokoll för att upptäcka mål av intresse. De utvecklas med hjälp av olika djurvärdar, inklusive mus, råtta, kanin, get, får och många andra.
Monoklonala och
polyklonala antikroppar En typ av primära antikroppar, monoklonala antikroppar, ger hög reproducerbarhet och låg korsreaktivitet och bakgrundsljud. En annan typ, polyklonala antikroppar, kostar ofta mindre och ger större affinitet och snabbare bindning. Båda produceras med plasma B-celler, men den förra använder samma klon och den senare använder olika kloner. Monoklonala antikroppar kräver hybridomcellinjer, och polyklonala antikroppar gör det inte.
Det finns också rekombinanta monoklonala antikroppar med liknande fördelar, som hög affinitet, skalbarhet och specificitet. De tillverkas med hjälp av in vitro kloning av plasma B-celler och expressionsvärdar.
Konjugerade
primära antikroppar Antikroppar kan märkas med olika fluoroforer eller detektionsmedel eller användas utan märkningar. Märkta primära antikroppar, även kända som konjugerade primära antikroppar, hjälper forskare att förenkla och effektivisera sina applikationer. De är kopplade med vanliga enzymer och färgämnen som Alexa Fluor och används ofta i protein- och cellanalys.
Tillämpningar Antikroppar för biovetenskapliga tillämpningar används i flödescytometri, western blotting, ELISA, immunhistokemi och immuncytokemi. Sekundära antikroppar kan tillsättas för att stödja detektion och rening av vissa antigener. De binder till den primära antikroppen, som binder till antigenet av intresse. Att hitta rätt kombination av antikroppar kan resultera i större antigenspecificitet och en stark, detekterbar signal.
- (90)
- (8)
- (673,209)
- (6)
- (3)
- (552,946)
- (29,280)
- (64)
- (542)
- (79)
- (449)
- (368)
- (67)
- (5)
- (678)
- (2)
- (105)
- (11)
- (2)
- (3,994)
- (832)
- (27)
- (2)
- (1)
- (1)
- (4,207)
- (214)
- (5)
- (1)
- (30)
- (15)
- (1)
- (187)
- (52,045)
- (2)
- (82)
- (153)
- (148)
- (1,667)
- (3)
- (418)
- (354,259)
- (9,676)
- (9,503)
- (5,604)
- (61)
- (119)
- (15)
- (265,657)
- (374)
- (9,213)
- (6)
- (9)
- (1)
- (1)
- (4)
- (19)
- (16,145)
- (19)
- (1)
- (163)
- (140)
- (6,504)
- (102)
- (2)
- (97)
- (10)
- (29)
- (36)
- (3,030)
- (1,577)
- (197,117)
- (62,376)
- (118)
- (22)
- (181,394)
- (372,760)
- (2)
- (2)
- (3)
- (75)
- (775)
- (29,249)
- (32)
- (12,271)
- (374,288)
- (50)
- (2)
- (60)
- (234)
- (80,150)
- (432)
- (3)
- (49)
- (318)
- (680)
- (321)
- (179)
- (730)
- (50)
- (7,540)
- (602)
- (8)
- (6)
- (88)
- (303)
- (10)
- (716)
- (1,113)
- (58)
- (198)
- (3)
- (22,183)
- (1)
- (80)
- (8)
- (1,440)
- (72)
- (9,245)
- (5)
- (2)
- (352)
- (2)
- (111)
- (1,100)
- (8)
- (6)
- (11)
- (1,243)
- (1)
- (2,324)
- (374)
- (330)
- (2,963)
- (450)
- (84)
- (2)
- (3)
- (2,048)
- (183)
- (3)
- (11)
- (1)
- (811,516)
- (3)
- (1,638)
- (14)
- (25,277)
- (9)
- (4)
- (1)
- (10)
- (2,838)
- (66)
- (104)
- (301)
- (1)
- (4)
- (2)
- (1)
- (16)
- (31,172)
- (31,242)
- (6)
- (31,995)
- (16)
- (30,874)
- (56)
- (48)
- (31,210)
- (2)
- (31,841)
- (1)
- (3)
- (1)
- (74)
- (31,652)
- (31,160)
- (152)
- (121)
- (36)
- (174)
- (23)
- (108)
- (5)
- (16)
- (97)
- (97)
- (62)
- (16)
- (32,752)
- (11)
- (214)
- (713)
- (908)
- (607)
- (679)
- (805)
- (750)
- (866)
- (712)
- (1,240)
- (792)
- (717)
- (878)
- (918)
- (901)
- (1)
- (603)
- (918)
- (31)
- (8)
- (27,422)
- (839)
- (5)
- (124)
- (4)
- (655)
- (6)
- (148)
- (81)
- (48)
- (303)
- (13)
- (5)
- (3)
- (13)
- (4)
- (18)
- (26,857)
- (26,889)
- (26,985)
- (43)
- (26,930)
- (26,840)
- (40)
- (26,876)
- (26,864)
- (26,869)
- (8)
- (10)
- (5)
- (30,100)
- (3)
- (2)
- (42)
- (1)
- (4)
- (3)
- (4)
- (237)
- (1,273)
- (27,212)
- (14,110)
- (25,879)
- (4,866)
- (4,867)
- (25,830)
- (14,067)
- (7)
- (7)
- (13)
- (1)
- (182)
- (32)
- (55)
- (103)
- (56)
- (220)
- (278)
- (53)
- (152)
- (62)
- (14)
- (55)
- (80)
- (30)
- (123)
- (126)
- (167)
- (142)
- (134)
- (16)
- (68)
- (66)
- (42)
- (58)
- (103)
- (95)
- (177)
- (220)
- (73)
- (102)
- (118)
- (126)
- (78)
- (3)
- (449)
- (26,277)
- (7)
- (5)
- (243)
- (362)
- (2,758)
- (3,689)
- (2)
- (30)
- (265)
- (2,695)
- (2)
- (1)
- (61)
- (33)
- (22,614)
- (523)
- (612)
- (4)
- (14)
- (13)
- (5)
- (7)
- (62)
- (59)
- (872)
- (56)
- (1)
- (3)
- (1)
- (13)
- (5)
- (6)
- (39)
- (1)
- (370)
- (327)
- (169)
- (176)
- (115)
- (38)
- (16)
- (4)
- (5)
- (9)
- (3)
- (10)
- (2)
- (67)
- (5)
- (396,935)
- (271)
- (49)
- (442)
- (83)
- (60)
- (30)
- (320)
- (1)
- (23,625)
- (23,616)
- (23,583)
- (1)
- (2)
- (1)
- (1,192)
- (863)
- (1,680)
- (3,036)
- (1)
- (1)
- (1,284)
- (951)
- (718,022)
- (10,906)
- (7)
- (833)
- (52)
- (1)
- (5)
- (1)
- (4,904)
- (801)
- (1,518)
- (192)
- (1)
- (4)
- (4,082)
- (871)
- (3)
- (408)
- (2)
- (1)
- (2,094)
- (3,517)
- (1)
- (1)
- (1)
- (5)
- (1)
- (256)
- (133)
- (43)
- (1)
- (1)
- (1)
- (117)
- (230)
- (3)
- (1)
- (12)
- (262)
- (146,584)
- (202,279)
- (1)
- (805)
- (1)
- (10,001)
- (1)
- (2)
- (6)
- (7)
- (1)
- (6)
- (20)
- (1)
- (5)
- (34)
- (3)
- (4)
- (1)
- (102)
- (1)
- (1)
- (20)
- (9)
- (20)
- (3)
- (12,765)
- (350)
- (1)
- (2)
- (2)
- (209)
- (352)
- (219)
- (81)
- (1)
- (1)
- (6)
- (21,608)
- (2)
- (4,637)
- (1)
- (32)
- (1)
- (1)
- (4,347)
- (3,065)
- (1)
- (21)
- (1)
- (1)
- (1)
- (1,378)
- (15,581)
- (5,551)
- (284)
- (12)
- (7)
- (1)
- (71)
- (544)
- (6)
- (1)
- (1)
- (1)
- (1)
- (98)
- (1)
- (3)
- (1)
- (6)
- (2)
- (1)
- (13,006)
- (1)
- (20)
- (1)
- (107)
- (1)
- (5)
- (1)
- (1)
- (1)
- (4)
- (40)
- (4,898)
- (7)
- (2)
- (5)
- (4)
- (26)
- (246)
- (2)
- (10,950)
- (27,240)
- (1)
- (52)
- (1,205)
- (282)
- (3)
- (1)
- (2,184)
- (1)
- (4,171)
- (83)
- (27)
- (1)
- (1)
- (4)
- (29)
- (1)
- (984)
- (1)
- (1)
- (4)
- (7)
- (2)
- (6)
- (1)
- (565)
- (2,541)
- (1)
- (15)
- (1,588)
- (2)
- (3)
- (2)
- (5)
- (5)
- (55,611)
- (67)
- (96)
- (6)
- (1,391)
- (16,387)
- (35)
- (3)
- (2)
- (99)
- (2)
- (4)
- (51)
- (3)
- (112)
- (8)
- (22)
- (521,113)
- (1)
- (4)
- (8)
- (566,184)
- (59,533)
- (28,904)
- (186)
Filtrerade sökresultat
Invitrogen™ GAPDH Loading Control Monoclonal Antibody (GA1R), HRP
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
Transthyretin Monoclonal Antibody (D2), Invitrogen™
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Innehåll och lagring | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
|---|---|
| Användningsområden | Western Blot,Immunohistochemistry (Paraffin),Western Blot |
| Form | Liquid |
| Värd art | Mouse |
| Klassificering | Monoclonal |
| Koncentration | 1 mg/mL |
| Primär eller sekundär | Primary |
| Antigen | Transthyretin |
| Gen | TTR |
| Klona | D2 |
| Gene Alias | AA408768; AI787086; Amyloidosis I; ATTR; carpal tunnel syndrome 1; CTS; CTS1; D17860; epididymis luminal protein 111; HEL111; HsT2651; Lr1; PALB; prealbumin; pre-albumin; prealbumin, amyloidosis type I; Tbpa; thyroxine-binding prealbumin; transthyretin; Tt; TTR |
| Reningsmetod | Protein A/G |
| Gensymboler | TTR |
| Immunogen | Recombinant Human PALB protein, Gly21-Glu147 (Accession #P02766). |
| Formulering | PBS with 50% glycerol and 0.05% Proclin 300; pH 7.4 |
| Målarter | Human |
| Regulatorisk status | RUO |
| Isotyp | IgG1 κ |
| Genaccessionsnr. | P02766 |
| Konjugera | Unconjugated |
| Gen-ID (Entrez) | 7276 |
Invitrogen™ Pab1p Monoclonal Antibody (1G1)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Mouse Monoclonal Antibody
| Användningsområden | Immunohistochemistry,Immunoprecipitation,Western Blot,Immunocytochemistry |
|---|---|
| Innehåll och lagring | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Form | Liquid |
| Värd art | Mouse |
| Klassificering | Monoclonal |
| Koncentration | Conc. Not Determined |
| Primär eller sekundär | Primary |
| Antigen | Pab1p |
| Gen | PAB1 |
| Klona | 1G1 |
| Gene Alias | Poly(A) binding protein |
| Gensymboler | PAB1 |
| Immunogen | Yeast polyA binding protein preparations. |
| Formulering | Cell culture media with 5mM sodium azide |
| Målarter | Yeast,Bacteria |
| Regulatorisk status | RUO |
| Produkttyp | Antibody |
| Isotyp | IgG2a |
| Genaccessionsnr. | P04147 |
| Konjugera | Unconjugated |
| Gen-ID (Entrez) | 856912 |
Invitrogen™ PGK1 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ HSP104 Polyclonal Antibody
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rabbit Polyclonal Antibody
Invitrogen™ alpha Tubulin Monoclonal Antibody (YL1/2)
Greener Choice Product
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
This product offers one or more environmental benefits itemized in the U.S. FTC Green Guides.
Learn More About the Greener Choice Program
Rat Monoclonal Antibody
Histone H2B, ubiquitylated Lys123 Antibody (1B3F12/A9), HRP, Novus Biologicals™
Mouse Monoclonal Antibody
| Innehåll och lagring | Store at -20°C. Avoid freeze-thaw cycles. |
|---|---|
| Användningsområden | ELISA,Western Blot |
| Form | Purified |
| Värd art | Rabbit |
| Klassificering | Polyclonal |
| Primär eller sekundär | Primary |
| Antigen | NXF1 |
| Gene Alias | DKFZp667O0311, Mex67, mRNA export factor TAP, nuclear RNA export factor 1, TAPMEX67, tip associating protein, Tip-associated protein, Tip-associating protein |
| Reningsmetod | Affinity purified |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human NXF1 (NP_006353.2).,, Sequence:, ILNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQNIDVVLNRRSCMAATLRIIEENIPELLSLNLSNNRLYRLDDMSSIVQKAPNLKILNLSG |
| Formulering | PBS (pH 7.3), 50% glycerol |
| Målarter | Human,Mouse,Rat |
| Regulatorisk status | RUO |
| Utspädning | Western Blot 1:500 - 1:1000, ELISA |
| Isotyp | IgG |
| Konjugera | Unconjugated |
| Gen-ID (Entrez) | 10482 |