missing translation for 'onlineSavingsMsg'
Learn More

ADAMTS2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP3-17208-25UL

Product Code. 18322814

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

ADAMTS2 Polyclonal antibody specifically detects ADAMTS2 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	ADAMTS2
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	A disintegrin and metalloproteinase with thrombospondin motifs 2, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 2, ADAM metallopeptidase with thrombospondin type 1 motif, 2, ADAM-TS 2, ADAMTS-2, ADAM-TS2EC 3.4.24.14, ADAMTS-3, EC 3.4.24, NPIDKFZp686F12218, PC I-NP, PCI-NP, PCINPhPCPNI, PCPNI, pNPI, Procollagen I N-proteinase, Procollagen I/II amino propeptide-processing enzyme, Procollagen N-endopeptidase
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: IEPLEKGLAAQEAEQGRVHVVYRRPPTSPPLGGPQALDTGASLDSLDSLSRALGVLEEHANSSRRRARRHAADDDYNIEV
Quantity	25 μg
Research Discipline	Angiogenesis, Cancer, Extracellular Matrix
Gene ID (Entrez)	9509
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description