missing translation for 'onlineSavingsMsg'
Learn More

GABA-A R gamma 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-17492-25UL

Product Code. 18323553

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

GABA-A R gamma 1 Polyclonal antibody specifically detects GABA-A R gamma 1 in Human samples. It is validated for Immunofluorescence

Specifications

Antigen	GABA-A R gamma 1
Classification	Polyclonal
Dilution	Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Gene Alias	DKFZp686H2042, GABA(A) receptor subunit gamma-1, gamma-1 polypeptide, gamma-aminobutyric acid (GABA) A receptor, gamma 1, gamma-aminobutyric acid receptor subunit gamma-1, MGC33838
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC
Quantity	25 μg
Research Discipline	Stem Cell Markers
Gene ID (Entrez)	2565
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Product Suggestions

Description