missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GABA-A R gamma 1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17492-25UL
This item is not returnable.
View return policy
Description
GABA-A R gamma 1 Polyclonal antibody specifically detects GABA-A R gamma 1 in Human samples. It is validated for ImmunofluorescenceSpecifications
GABA-A R gamma 1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
DKFZp686H2042, GABA(A) receptor subunit gamma-1, gamma-1 polypeptide, gamma-aminobutyric acid (GABA) A receptor, gamma 1, gamma-aminobutyric acid receptor subunit gamma-1, MGC33838 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: NKASMTPGLHPGSTLIPMNNISVPQEDDYGYQCLEGKDC | |
25 μg | |
Stem Cell Markers | |
2565 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |