missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human FZD6 Partial ORF (NP_003497, 71 a.a. - 181 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

4630.00 SEK - 7020.00 SEK

Specifications

Accession Number	NP_003497
For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez)	8323
Molecular Weight (g/mol)	37.95kDa

View More Specs

Products 2

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
16118425 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00008323-Q01.25ug	25 μg	7020.00 SEK 25µg		Please sign in to purchase this item. Need a web account? Register with us today!

16108425 View Documents missing translation for 'viewProductCertificates'	Abnova™ H00008323-Q01.10ug	10 μg	4630.00 SEK 10µg		Please sign in to purchase this item. Need a web account? Register with us today!

Description

This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The protein encoded by this family member contains a signal peptide, a cysteine-rich domain in the N-terminal extracellular region, and seven transmembrane domains, but unlike other family members, this protein does not contain a C-terminal PDZ domain-binding motif. This protein functions as a negative regulator of the canonical Wnt/beta-catenin signaling cascade, thereby inhibiting the processes that trigger oncogenic transformation, cell proliferation, and inhibition of apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq]

Sequence: PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQC

Specifications

Accession Number	NP_003497
Formulation	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Weight (g/mol)	37.95kDa
Quality Control Testing	12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Requirements	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Gene Alias	Hfz6
Gene Symbol	FZD6
Recombinant	Recombinant
Expression System	wheat germ expression system

For Use With (Application)	Antibody Production, ELISA, Protein Array, Western Blot
Gene ID (Entrez)	8323
Name	FZD6 (Human) Recombinant Protein (Q01)
Immunogen	PNIETFLCKAFVPTCIEQIHVVPPCRKLCEKVYSDCKKLIDTFGIRWPEELECDRLQYCDETVPVTFDPHTEFLGPQKKTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQC
Regulatory Status	RUO
Common Name	FZD6
Species	Wheat Germ (in vitro)
Protein Tag	GST
Form	Liquid

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Abnova™ Human FZD6 Partial ORF (NP_003497, 71 a.a. - 181 a.a.) Recombinant Protein with GST-tag at N-terminal

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Abnova™ Human FZD6 Partial ORF (NP_003497, 71 a.a. - 181 a.a.) Recombinant Protein with GST-tag at N-terminal

Specifications

Description

Specifications

Documents