missing translation for 'onlineSavingsMsg'
Learn More

MBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

4387.57 SEK

Antigen	MBD4
Dilution	Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18332385 View Documents Promotion Details missing translation for 'viewProductCertificates'	Bio-Techne NBP3-10344-100UL	100 μg	4387.57 SEK 100µL View alternative products Save Up to »		Please sign in to purchase this item. Need a web account? Register with us today!

Description

MBD4 Polyclonal specifically detects MBD4 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.

Specifications

Antigen	MBD4
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human
Gene Alias	EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human MBD4 (NP_003916). Peptide sequence CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
Purification Method	Affinity purified

Dilution	Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	8930
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Description