missing translation for 'onlineSavingsMsg'
Learn More
Learn More
MBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
4480.00 SEK
Specifications
Antigen | MBD4 |
---|---|
Dilution | Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
MBD4 Polyclonal specifically detects MBD4 in Human samples. It is validated for Western Blot, Chromatin Immunoprecipitation.Specifications
MBD4 | |
Polyclonal | |
Purified | |
RUO | |
Human | |
EC 3.2.2.-, G/T mismatch glycosylase, G/U mismatch glycosylase, MED1G/5-fluorouracil mismatch glycosylase with biphasic kinetics, methyl-CpG binding domain protein 4, methyl-CpG-binding domain protein 43,N(4)-ethenocytosine glycosylase, Methyl-CpG-binding endonuclease 1, Methyl-CpG-binding protein MBD4, Mismatch-specific DNA N-glycosylase, putative methyl-CpG binding protein | |
The immunogen is a synthetic peptide directed towards the middle region of human MBD4 (NP_003916). Peptide sequence CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT | |
Affinity purified |
Western Blot 1.0 ug/ml, Chromatin Immunoprecipitation | |
Unconjugated | |
Rabbit | |
Base Excision Repair, Chromatin Research, DNA Repair, Epigenetics | |
PBS buffer, 2% sucrose | |
8930 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
MBD4 Rabbit anti-Human, Polyclonal, Novus Biologicals™