missing translation for 'onlineSavingsMsg'
Learn More
Learn More
NDUFB8 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Bio-Techne NBP3-17898-25UL
This item is not returnable.
View return policy
Description
NDUFB8 Polyclonal antibody specifically detects NDUFB8 in Human samples. It is validated for Western BlotSpecifications
NDUFB8 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml | |
CI-ASHImitochondrial, NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8 (19kD, ASHI), NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 8, 19kDa, NADH:ubiquinone oxidoreductase ASHI subunit, NADH-ubiquinone oxidoreductase ASHI subunit | |
This antibody was developed against Recombinant Protein corresponding to amino acids: YPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI | |
25 μg | |
Core ESC Like Genes, Stem Cell Markers | |
4714 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |