missing translation for 'onlineSavingsMsg'
Learn More

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

6030.00 SEK - 17200.00 SEK

Specifications

For Use With (Application)	In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Formulation	PBS
Gene ID (Entrez)	6622
Name	Human alpha-Synuclein Aggregate Protein
Purification Method	>95% pure by SDS-PAGE

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
18735843 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals™ NBP2-54789-100UG	100 μg	6030.00 SEK 1 set		Please sign in to purchase this item. Need a web account? Register with us today!

18681109 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals™ NBP2-54789-200ug	200 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

18624596 View Documents missing translation for 'viewProductCertificates'	Novus Biologicals™ NBP2-54789-500ug	500 μg	This item is currently unavailable or has been discontinued. View the product page for possible alternatives.		N/A

Description

An un-tagged full length Human biologically active Alpha-Synuclein recombinant protein aggregate (pre-formed fibrils, Type 1), NCBI Accession #: NP_000336.1. The Recombinant Human alpha-Synuclein Aggregate Protein is derived from E. coli. The Recombinant Human alpha-Synuclein Aggregate Protein has been validated for the following applications: Western Blot, In vitro assay, In vivo assay, SDS-Page, Bioactivity.

Specifications

For Use With (Application)	In vitro Assay, In vivo Assay, SDS-PAGE, Western Blot
Gene ID (Entrez)	6622
Purification Method	>95% pure by SDS-PAGE
Immunogen	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Gene Alias	alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Product Type	Recombinant Protein
Cross Reactivity	Human

Formulation	PBS
Name	Human alpha-Synuclein Aggregate Protein
Source	E.Coli
Regulatory Status	RUO
Gene Symbol	SNCA
Conjugate	Unconjugated
Recombinant	Recombinant

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Specifications

Description

Specifications

Documents