missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ S100A11 (Human) Recombinant Protein
Human S100A11 partial ORF ( AAH14354.1, 10 a.a. - 87 a.a.) recombinant protein with GST-tag at N-terminal.
4630.00 SEK - 7020.00 SEK
Specifications
Accession Number | AAH14354.1 |
---|---|
Gene ID (Entrez) | 6282 |
Name | S100 calcium binding protein A11 |
Preparation Method | Wheat germ expression system |
Quality Control Testing | 125% SDS-PAGE Stained with Coomassie Blue |
Description
- Sequence: TERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEFLNLIGGL
Specifications
AAH14354.1 | |
S100 calcium binding protein A11 | |
125% SDS-PAGE Stained with Coomassie Blue | |
MLN70, S100C | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
6282 | |
Wheat germ expression system | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
S100A11 | |
GST |
Safety and Handling
missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ S100A11 (Human) Recombinant Protein