missing translation for 'onlineSavingsMsg'
Learn More

VSX1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10435-100UL

Product Code. 18323165

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

VSX1 Polyclonal specifically detects VSX1 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	VSX1
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	CAASDS, KTCN, KTCN1, PPCD, PPD, RINX, VSX1 visual system homeobox 1
Immunogen	The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse VSX1 (NP_473409). Peptide sequence TGMRKPESEDKLAGLWEFDHLKKGANKDEDGPERGPDETTQNPENSLEDV
Quantity	100 μg
Primary or Secondary	Primary
Target Species	Mouse
Form	Purified

Applications	Western Blot
Conjugate	Unconjugated
Formulation	PBS buffer, 2% sucrose
Host Species	Rabbit
Purification Method	Affinity purified
Regulatory Status	RUO
Gene ID (Entrez)	30813
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description