UserName
Bio-Techne is a global developer, manufacturer, and supplier of high-quality reagents, analytical instruments, and precision diagnostics. Whether you’re at the cutting edge of academic research, translating basic discoveries into therapeutic leads, or at a facility that requires the highest level of diagnostic testing, our award-winning tools and solutions empower scientists and clinicians to achieve reproducible and consistent results. Choosing Bio‑Techne means having confidence that every solution you use will help move you towards better answers.
Paris, France 01-05-2024
Thermo Fisher Scientific, a leading provider of laboratory products and services, is pleased to announce a significant milestone in its commitment to providing cutting-edge solutions to its customers. Effective May 1, 2024, Thermo Fisher will enter into a strategic European distribution agreement with Bio-Techne (NASDAQ: TECH), a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities.
This partnership marks an important collaboration between two industry leaders in the fields of scientific research, diagnostics, and biotechnology. Under this agreement, Thermo Fisher, through the Fisher Scientific channel, Europe, will distribute Bio-Techne's extensive portfolio of innovative products, including antibodies, proteins, immunoassay kits, reagents and enzymes to laboratories and research institutions across Europe.
"We are thrilled to forge this partnership with Bio-Techne, a company renowned for its pioneering advancements in the life sciences industry," said Claire Wallace, President, Fisher Scientific channel, Europe. "By adding Bio-Techne's high-quality products to our comprehensive portfolio, we aim to further empower scientists and researchers with the tools they need to drive breakthrough discoveries and advancements in healthcare."
Bio-Techne's state-of-the-art products are designed to accelerate research and improve outcomes in areas including cell and gene therapy, immunology, neuroscience, and more. With this collaboration, Thermo Fisher reinforces its commitment to providing customers with access to the latest technologies and expertise, ultimately advancing scientific knowledge and improving human health.
"We are excited to partner with Thermo Fisher to expand the reach of our products and services throughout Europe," said Kim Kelderman, Bio-Techne’s President and Chief Executive Officer. "By leveraging the Fisher Scientific Channel's extensive European distribution network and industry expertise, we aim to enhance support for researchers and accelerate scientific discoveries that address some of the most pressing challenges in healthcare today."
This distribution agreement underscores Thermo Fisher's dedication to fostering innovation and collaboration within the scientific community. Through strategic partnerships with leading companies like Bio-Techne, Thermo Fisher continues to strengthen its position as a trusted partner for researchers and laboratories across Europe.
Bio-Techne Corporation (NASDAQ: TECH) is a global life sciences company providing innovative tools and bioactive reagents for the research and clinical diagnostic communities. Bio-Techne products assist scientific investigations into biological processes and the nature and progress of specific diseases. They aid in drug discovery efforts and provide the means for accurate clinical tests and diagnoses. With thousands of products in its portfolio, Bio-Techne generated over $1.1 billion in net sales in fiscal year 2023 and has approximately 3,100 employees worldwide.
Questions? Reach Out to a Specialist >
Human Monoclonal Antibody
Content And Storage | Store at -20°C in powder form. Store at -80°C once reconstituted. |
---|---|
Target Species | Human |
Host Species | Human |
Conjugate | Unconjugated |
Applications | Flow Cytometry,ELISA,Functional Assay |
Form | Purified |
Isotype | IgG1 |
Gene Accession No. | Q05329 |
Research Discipline | Diabetes Research, Immune System Diseases, Immunology, Lipid and Metabolism, Neuronal Cell Markers, Neuroscience |
Antigen | GAD2/GAD65 |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | EC 4.1.1, EC 4.1.1.15, GAD-65, GAD65MGC161605, glutamate decarboxylase 2, glutamate decarboxylase 2 (pancreatic islets and brain, 65kD), glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa), Glutamate decarboxylase 65 kDa isoform, Glutamate decarboxylase-2 (pancreas), MGC161607,65 kDa glutamic acid decarboxylase |
Gene ID (Entrez) | 2572 |
Formulation | Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2) |
Immunogen | GAD65 |
Classification | Monoclonal |
Reconstitution | Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex. |
Primary or Secondary | Primary |
Clone | U.Washington patent anti-GAD65 |
Rabbit Polyclonal Antibody has been used in 4 publications
Antigen | Factor VIII |
---|---|
Gene Symbols | F8 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Target Species | Mouse,Rat |
Host Species | Rabbit |
Applications | Western Blot,Immunofluorescence,Immunohistochemistry (Paraffin) |
Immunogen | A synthetic peptide made to a C-terminal portion of human Factor VIII (between amino acids 2100-2250) [UniProt P00451] |
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Isotype | IgG |
Antigen | NPLOC4 |
Gene Symbols | NPLOC4 |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Gene Alias | FLJ20657, FLJ23742, KIAA1499nuclear protein localization protein 4 homolog, NPL4Protein NPL4, nuclear protein localization 4 homolog (S. cerevisiae) |
Gene ID (Entrez) | 55666 |
Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:VRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLIIDITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLLLFLVTNE |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Specificity of human NPLOC4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Rabbit Polyclonal Antibody has been used in 156 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat,Pig,Goat,Hamster,Sheep,Squirrel |
Host Species | Rabbit |
Conjugate | Unconjugated |
Applications | Western Blot,ChIP Assay,Flow Cytometry,Immunohistochemistry,Immunocytochemistry,Immunoprecipitation |
Isotype | IgG |
Gene Accession No. | Q9UBK2 |
Research Discipline | Cancer, Cholesterol Metabolism, Chromatin Research, Diabetes Research, Lipid and Metabolism, mTOR Pathway, Neuroscience, Transcription Factors and Regulators |
Concentration | 1.0 mg/mL |
Antigen | PGC1 alpha |
Gene Symbols | PPARGC1A |
Regulatory Status | RUO |
Purification Method | Affinity Purified |
Dilution | Western Blot 1 - 2 ug/ml, Chromatin Immunoprecipitation reported by customer review, Flow Cytometry 1 - 2.5 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1:1000. Use reported in scientific literature (PMID 24508229), Immunoprecipitation reported in scientific literature (PMID 24769256), Immunohistochemistry-Paraffin 1:200, Immunohistochemistry-Frozen reported in scientific literature (PMID 25981953), Flow (Intracellular) 1 - 2.5 ug/ml, Chromatin Immunoprecipitation (ChIP), Knockout Validated, KnockDown Validated reported in scientific literature (PMID 35455432) |
Molecular Weight of Antigen | 91 kDa |
Gene Alias | LEM6, Ligand effect modulator 6, ligand effect modulator-6, L-PGC-1alpha, peroxisome proliferative activated receptor, gamma, coactivator 1, alpha, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-3ext, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B4-8a, peroxisome proliferator-activated receptor gamma coactivator 1 alpha transcript variant B5-NT, peroxisome proliferator-activated receptor gamma coactivator 1-alpha, peroxisome proliferator-activated receptor gamma, coactivator 1 alpha, PGC1, PGC-1(alpha), PGC1A, PGC-1-alpha, PGC1APGC-1(alpha), PGC1peroxisome proliferative activated receptor, gamma, coactivator 1, PGC-1v, PPAR gamma coactivator variant form, PPAR gamma coactivator-1, PPARgamma coactivator 1alpha, PPAR-gamma coactivator 1-alpha, PPARGC1, PPARGC-1-alpha |
Gene ID (Entrez) | 10891 |
Formulation | PBS with 0.02% Sodium Azide |
Immunogen | This PGC1 alpha Antibody was developed against a recombinant protein made to an internal portion of the human PGC-1 alpha protein (within residues 400-550). [Swiss-Prot# Q9UBK2]. |
Classification | Polyclonal |
Primary or Secondary | Primary |
Test Specificity | Human and Mouse. Squirrel reactivity reported in the scientific literature. Expected reactivity based on sequence identity: monkey (98%), equine (94%), canine (93%) and rat (88%). Rat reactivity reported in scientific literature (PMID: 22208735). |
Content And Storage | Store at 4°C short term. Store at -20°C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Mouse,Rat,Pig,Bovine |
Host Species | Goat |
Conjugate | Unconjugated |
Applications | Western Blot,Immunofluorescence |
Form | Purified |
Research Discipline | Hypoxia Signaling, Immune System Diseases, Immunology, Neuroscience, Neurotransmission, Oligodendrocyte Cell Markers, Stem Cell Markers |
Concentration | 1 mg/mL |
Antigen | MBP |
Regulatory Status | RUO |
Purification Method | Immunogen affinity purified |
Dilution | Western Blot 1:5000-10000, Immunocytochemistry/ Immunofluorescence 1:2000-5000 |
Gene Alias | MGC99675, Myelin A1 protein, myelin basic protein, Myelin membrane encephalitogenic protein |
Gene ID (Entrez) | 4155 |
Formulation | 50% PBS, 50% glycerol |
Immunogen | Purified MBP isolated from bovine brain |
Classification | Polyclonal |
Primary or Secondary | Primary |
Highly purified. Generating reliable and reproducible results. Applications: SDS-Page
Regulatory Status | RUO |
---|---|
Purification Method | SDS-PAGE |
Purity or Quality Grade | >90% |
Conjugate | Unconjugated |
Common Name | Mannose Phosphate Isomerase |
Molecular Weight (g/mol) | 41.9kDa |
Formulation | Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 5% glycerol |
Quantity | 0.5 mg |
Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
For Use With (Application) | SDS-PAGE |
Source | Human |
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
---|---|
Gene Alias | carnitine O-palmitoyltransferase 2, mitochondrial, carnitine palmitoyltransferase 2, Carnitine palmitoyltransferase IIEC 2.3.1.21, CPT II, CPT1, CPTASE |
Molecular Weight (g/mol) | M.W. (Theoretical): 36.74 kDa |
Gene ID (Entrez) | 1376 |
Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Gene Symbol | CPT2 |
Research Category | Cancer, Cardiovascular Biology, Endocrinology, Signal Transduction |
Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
For Use With (Application) | Western Blot,ELISA,PAGE,Protein Array,Immunoaffinity Purification |
Protein | CPT2 |
Purity or Quality Grade | >80% by SDS-PAGE and Coomassie blue staining |
---|---|
Gene Alias | carnitine O-palmitoyltransferase 1, liver isoform, Carnitine O-palmitoyltransferase I, liver isoform, Carnitine palmitoyltransferase 1A, carnitine palmitoyltransferase 1A (liver), carnitine palmitoyltransferase I, liver, CPT I, CPT1, CPT1-LEC 2.3.1.21, CPTI-L, EC 2.3.1, L-CPT1 |
Molecular Weight (g/mol) | M.W. (Theoretical): 35.64 kDa |
Gene ID (Entrez) | 1374 |
Formulation | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Gene Symbol | CPT1A |
Research Category | Neuroscience |
Storage Requirements | Store at -80C. Avoid freeze-thaw cycles. |
For Use With (Application) | Western Blot,ELISA,Protein Array,Immunoaffinity Purification |
Protein | CPT1A |
Content And Storage | Store at -20°C in powder form. Store at -80°C once reconstituted. |
---|---|
Target Species | Human |
Host Species | Human |
Conjugate | Unconjugated |
Applications | Flow Cytometry,ELISA,Functional Assay |
Form | Purified |
Isotype | IgG1 |
Gene Accession No. | P01375 |
Research Discipline | Adaptive Immunity, Asthma, Autoimmune Diseases, Autophagy, Cancer, Cytokine Research, Diabetes Research, Immune System Diseases, Immunology, Innate Immunity |
Antigen | TNF-alpha |
Regulatory Status | RUO |
Purification Method | Protein A purified |
Gene Alias | APC1 protein, Cachectin, DIF, TNF, monocyte-derived, TNF-a, TNF-alphacachectin, TNFATNF, macrophage-derived, TNFSF2TNF superfamily, member 2, tumor necrosis factor, tumor necrosis factor (TNF superfamily, member 2), tumor necrosis factor alpha, Tumor necrosis factor ligand superfamily member 2, tumor necrosis factor-alpha |
Gene ID (Entrez) | 7124 |
Formulation | Lyophilized from 25mM histidine, 8% sucrose, 0.01% Tween80 (pH6.2) |
Immunogen | TNFSF2/ TNFa |
Classification | Monoclonal |
Reconstitution | Reconstitute with sterile, distilled water to a final concentration of 1 mg/mL. Gently shake to solubilize completely. Do not vortex. |
Primary or Secondary | Primary |
Clone | adalimumab |
Mouse Monoclonal Antibody has been used in 29 publications
Content And Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
---|---|
Target Species | Human,Sheep,Xenopus species,Yeast,Chinese Hamster,Mouse,Rat,Plant,Protozoa,Rabbit,Fungi,Plant,Protozoa,Rabbit |
Host Species | Mouse |
Conjugate | Unconjugated |
Applications | Western Blot,Flow Cytometry,ELISA,Immunohistochemistry,Immunocytochemistry,Immunofluorescence,Immunohistochemistry (Paraffin) |
Form | Purified |
Isotype | IgM Îş |
Research Discipline | Angiogenesis, Cancer, Cell Biology, Cellular Markers, Cytoskeleton Markers, Stem Cell Markers |
Concentration | 1.0 mg/mL |
Antigen | Actin |
Gene Symbols | ACTA1 |
Regulatory Status | RUO |
Purification Method | IgM purified |
Dilution | Western Blot 1:100-1:1000, Simple Western 1:25, Flow Cytometry 1 ug/ml, ELISA 1:100 - 1:2000, Immunohistochemistry 1:200, Immunocytochemistry/Immunofluorescence 1:20-1:100, Immunohistochemistry-Paraffin 1:200, Flow (Intracellular) 1 ug/ml |
Gene Alias | ACTA, actin, alpha 1, skeletal muscle, alpha skeletal muscle, alpha skeletal muscle actin, alpha-actin-1, ASMA, CFTD, CFTDM, MPFD, NEM1, NEM2, NEM3 |
Gene ID (Entrez) | 58 |
Immunogen | Purified recombinant Arabidopsis Actin protein [UniProt# P0CJ46] |
Classification | Monoclonal |
Primary or Secondary | Primary |
Test Specificity | Reacts with Actin 1, 2, 3, 4, 7, 8, 11 and 12. |
Clone | mAbGEa |