missing translation for 'onlineSavingsMsg'
Learn More

Bcl-2 related protein A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Bio-Techne NBP3-10872-100UL

Product Code. 18322165

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Bcl-2 related protein A1 Polyclonal specifically detects Bcl-2 related protein A1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	Bcl-2 related protein A1
Classification	Polyclonal
Dilution	Western Blot 1.0 ug/ml
Gene Alias	ACC-1, ACC-2, Bcl2-L-5, BCL2L5HBPA1, Bcl-2-like protein 5, BCL2-related protein A1, BFL1bcl-2-related protein A1, GRSbcl2-L-5, hematopoietic BCL2-related protein A1, Hemopoietic-specific early response protein, Protein BFL-1, Protein GRS
Immunogen	The immunogen is a synthetic peptide directed towards the C terminal region of human Bcl-2 related protein A1 (NP_004040). Peptide sequence FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY
Quantity	100 μg
Research Discipline	Apoptosis, Cancer
Gene ID (Entrez)	597
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Product Suggestions

Description