missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human AMPD2 Partial ORF (NP_631895, 86 a.a. - 185 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00000271-Q01.10ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16181541

  • 3343.96 SEK / 10µg

Estimated Shipment: 12-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Adenosine monophosphate deaminase-2 (EC 3.5.4.6) catalyzes the deamination of AMP to IMP and plays an important role in the purine nucleotide cycle.[supplied by OMIM]

Sequence: ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
Specifications

Specifications

NP_631895
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
36.74kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQRVTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT
RUO
AMPD2
Yes
wheat germ expression system
Liquid
271
AMPD2 (Human) Recombinant Protein (Q01)
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
AMPD2
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates