missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IFNA5 Full-length ORF (NP_002160.1, 1 a.a. - 189 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003442-P01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136601

  • 5030.41 SEK / 25µg

Estimated Shipment: 16-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

Sequence: MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Specifications

Specifications

NP_002160.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
48.3kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
INFA5
IFNA5
Yes
wheat germ expression system
Liquid
3442
IFNA5 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
RUO
IFNA5
Wheat Germ (in vitro)
GST
Videos
SDS
Documents
Certificates