missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human IL13 Partial ORF (NP_002179, 35 a.a. - 146 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Brand:  Abnova™ H00003596-Q01.25ug

Additional Details : Weight : 0.00010kg

 View more versions of this product

Product Code. 16136841

  • 5030.41 SEK / 25µg

Estimated Shipment: 09-11-2021

Please to purchase this item. Need a web account? Register with us today!


Description

Description

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq]

Sequence: GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
Specifications

Specifications

NP_002179
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
38.06kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN
RUO
IL13
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
3596
IL13 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ALRH/BHR1/IL-13/MGC116786/MGC116788/MGC116789/P600
IL13
Yes
Videos
SDS
Documents
Certificates