missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human MUC12 Partial ORF (XP_379904.2, 391 a.a. - 465 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Brand: Abnova™ H00010071-Q01.25ug
Additional Details : Weight : 0.00010kg
Description
Sequence: SQRKRHREQYDVPQEWRKEGTPGIFQKTAIWEDQNLRESRFGLENAYNNFRPTLETVDSGTELHIQRPEMVASTVSpecifications
| XP_379904.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.99kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| SQRKRHREQYDVPQEWRKEGTPGIFQKTAIWEDQNLRESRFGLENAYNNFRPTLETVDSGTELHIQRPEMVASTV | |
| RUO | |
| MUC12 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 10071 | |
| MUC12 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| MUC11 | |
| MUC12 | |
| Recombinant | |
| wheat germ expression system |