missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human PRKAR1B Partial ORF (NP_002726.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Quantity:
10 ug
25 ug
Unit Size:
10µg
25µg
Description
Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism, ion transport, and gene transcription. The PKA holoenzyme is composed of 2 regulatory and 2 catalytic subunits and dissociates from the regulatory subunits upon binding of cAMP.[supplied by OMIM]
Sequence: MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPV
Specifications
Specifications
Accession Number | NP_002726.1 |
For Use With (Application) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulation | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene ID (Entrez) | 5575 |
Molecular Weight (g/mol) | 35.64kDa |
Name | PRKAR1B (Human) Recombinant Protein (Q01) |
Quality Control Testing | 12.5% SDS-PAGE Stained with Coomassie Blue |
Quantity | 10 ug |
Immunogen | MASPPACPSEEDESLKGCELYVQLHGIQQVLKDCIVHLCISKPERPMKFLREHFEKLEKEENRQILARQKSNSQSDSHDEEVSPTPPNPV |
Storage Requirements | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Show More |
Product Suggestions
Customers who viewed this item also viewed.
Viewing 1-5 of 11
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Abnova™ Human PRKAR1B Partial ORF (NP_002726.1, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal >
Spot an opportunity for improvement?Share a Content Correction