missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human TRIM5 alpha (aa 282-353) Control Fragment Recombinant Protein Product Code.: 30194037
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30194037

Invitrogen™ Human TRIM5 alpha (aa 282-353) Control Fragment Recombinant Protein

Product Code. 30194037
100 μL, 100µL
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30194037

Brand: Invitrogen™ RP93597

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (30%), Rat (30%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the tripartite motif family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein forms homo-oligomers via the coiled-coil region and localizes to cytoplasmic bodies. It appears to function as a E3 ubiquitin-ligase and ubiquitinates itself to regulate its subcellular localization. It may play a role in retroviral restriction. Multiple alternatively spliced transcript variants encoding different isoforms have been described for this gene.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9C035
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85363
Name Human TRIM5 alpha (aa 282-353) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias EG667823; Gm8833; HGNC:16276; OTTHUMP00000069812; RING finger protein 88; RING-type E3 ubiquitin transferase TRIM5; RNF88; TRIM5; Trim5 alpha; TRIM5 alpha; predicted E3 ubiquiting ligase; TRIM5 gamma; predicted E3 ubiquiting ligase; trim5a; TRIM5alpha; tripartite motif containing 5; tripartite motif containing 5 transcript variant iota; tripartite motif containing 5 transcript variant kappa; tripartite motif protein TRIM5; tripartite motif-containing 5; tripartite motif-containing 5 alpha isoform; tripartite motif-containing 5 gamma isoform; tripartite motif-containing 5/cyclophilin A fusion protein; tripartite motif-containing protein 5; tripartite motif-containing protein 5 isoform alpha
Common Name TRIM5 alpha
Gene Symbol Trim5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGMLEVFRELTDVRRYWVDVTVAPNNISCAVISEDKRQVSSPKPQIIYGARGTRYQTFVNFNYCTGILGSQS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human TRIM5 alpha (aa 282-353) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.