missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-2 gp-36 397aa Protein

A cDNA sequence encoding the HIV-2 gp-36 397aa was constructed and used to recombinantly synthesize the protein.

2690.00 SEK - 20560.00 SEK

Name	HIV-2 gp-36 397aa Protein
Regulatory Status	Research Use Only
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type	Recombinant Protein
Cross Reactivity	HIV

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
15989888 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP12270-100UG	100 μg	2690.00 SEK 100µg View alternative products Save Up to »	Estimated Shipment: 26-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15909898 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP12270-500UG	500 μg	10265.00 SEK 500µg View alternative products Save Up to »	Estimated Shipment: 26-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

15999888 View Documents Promotion Details missing translation for 'viewProductCertificates'	enQuireBio™ QP12270-1MG	1 mg	20560.00 SEK 1mg View alternative products Save Up to »	Estimated Shipment: 26-06-2024 Log in to see stock.	Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Name	HIV-2 gp-36 397aa Protein
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	HIV
Protein Tag	Untagged
Buffer	0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.

Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	E. coli
Sequence	EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
Purity or Quality Grade	Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.

Description