missing translation for 'onlineSavingsMsg'
Learn More

enQuireBio™ Recombinant HIV-2 gp-36 397aa Protein

A cDNA sequence encoding the HIV-2 gp-36 397aa was constructed and used to recombinantly synthesize the protein.

2800.00 SEK - 20560.00 SEK

Specifications

Name	HIV-2 gp-36 397aa Protein
Regulatory Status	Research Use Only
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Product Type	Recombinant Protein
Cross Reactivity	HIV

View More Specs

Products 3

Product Code	Brand	Quantity	Price	Quantity & Availability
Product Code	Brand	Quantity	Price	Quantity & Availability
15989888 View Documents missing translation for 'viewProductCertificates'	enQuireBio™ QP12270-100ug	100 μg	2800.00 SEK 100µg		Please sign in to purchase this item. Need a web account? Register with us today!

15909898 View Documents missing translation for 'viewProductCertificates'	enQuireBio™ QP12270-500ug	500 μg	10695.00 SEK 500µg		Please sign in to purchase this item. Need a web account? Register with us today!

15999888 View Documents missing translation for 'viewProductCertificates'	enQuireBio™ QP12270-1mg	1 mg	20560.00 SEK 1mg		Please sign in to purchase this item. Need a web account? Register with us today!

Specifications

Name	HIV-2 gp-36 397aa Protein
Endotoxin Concentration	Not Determined. Testing recommended prior to use in cell culture and can be performed upon request.
Cross Reactivity	HIV
Protein Tag	Untagged
Buffer	0.01M Na2CO3, 0.01M Na3EDTA, 0.014 Mb-mercaptoethanol, 0.05% Tween-20.

Regulatory Status	Research Use Only
Product Type	Recombinant Protein
Species	E. coli
Sequence	EQTMVQDDPSTCRGEFLYCNMTWFLNWIENKTHRNYAPCHIKQIINTWHKVGRNVYLPPREGELSCNSTVTSIIANIDWQNNNQTNITFSAEVAELYRLELGDYKLVEITPIGFAPTKEKRYSSAHGRHTRGVFVLGFLGFLATAGSAMGAASLTVSAQSRTLLAGIVQQQQQLLDVVKRQQELLRLTVWGTKNLQARVTAIEKYLQDQARLNSWGCAFRQVCHTTVPWVNDSLAPDWDNMTWQEWEKQVRYLEANISKSLEQAQIQQEKNMYELQKLNSWDIFGNWFDLTSWVKYIQYGVLIIVAVIALRIVIYVVQMLSRLRKGYRPVFSSPPGYIQQIHIHKDRGQPANEETEEDGGSNGGDRYWPWPIAYIHFLIRQLIRLLTRLYSICSQAC
Purity or Quality Grade	Greater than 95.0% as determined by HPLC analysis and SDS-PAGE.

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

enQuireBio™ Recombinant HIV-2 gp-36 397aa Protein

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.

enQuireBio™ Recombinant HIV-2 gp-36 397aa Protein

Specifications

Description

Specifications

Documents