Sökresultatsida | Fisher Scientific

Bio-Techne (205)
Novus Biologicals (57,781)
R&D Systems (34)

specialprogram

Greener Choice (14)

Proteintillstånd

Denatured (2)
Native (14,849)

Rekombinant

Native (1)
Recombinant (2,402)

Värd art

Canine (2)
Chicken (2)
Goat (3)
Human (499)
Mouse (233)
Non-species Specific (1)
Primate (5)
Rabbit (238)
Rat (22)

Form

Ascites (2)
Liquid (3)
Lyophilized (2)
Purified (591)

1 – 15 av 50,200 Resultat

Novus Biologicals™ Flagellin Native Protein

Native Protein

Prissättning och tillgänglighet

Rekombinanta proteiner

Novus Biologicals™ Recombinant Protein A Protein

Recombinant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Förvaringskrav	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Gene Alias	Immunoglobulin G binding protein A, SPA, Staphylococcal protein A
Rekonstitution	Dissolve in distilled water or saline.
Molekylvikt (g/mol)	33.4 kDa
Formulering	Lyophilized from additive free solution.
Koncentration	LYOPH
Forskningskategori	Epitope Tags
För användning med (applikation)	PAGE,Bioactivity,HPLC
Protein	Protein A
Endotoxinkoncentration	Less than 0.1 EU/ug of Protein A as determined by LAL method.
Renhet eller kvalitetsklass	>97% pure by SDS-PAGE and HPLC
Gen-ID (Entrez)	3919448

Novus Biologicals™ Human Heart Whole Tissue Lysate (Adult Whole Normal)

Prissättning och tillgänglighet

Vävnadslysater

R&D Systems™ Human Thrombospondin-1 Quantikine ELISA Kit

Human Thrombospondin-1 Quantikine ELISA Kit from the most referenced ELISA manufacturer. Highly validated for accurate quantitation and long-term reproducibility.

Prissättning och tillgänglighet

Life Science Research ELISA Kit

Novus Biologicals Recombinant Human alpha-Synuclein Active, Pre-formed Fibrils, (Type 1), A53T Mutant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Gensymbol	SNCA
Förvaringskrav	Store at -80C. Avoid freeze-thaw cycles.
Gene Alias	alpha-synuclein, I+/--synuclein, MGC110988, NACP, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, PD1, SNCA, synuclein alpha-140, synuclein, alpha (non A4 component of amyloid precursor), truncated alpha synuclein
Formulering	PBS pH 7.4
Forskningskategori	Alzheimers Research, Apoptosis, Cell Biology, Cellular Markers, Neurodegeneration, Neuroscience
För användning med (applikation)	Electron Microscopy,In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Protein	alpha-Synuclein
Renhet eller kvalitetsklass	>95%, by SDS-PAGE
Gen-ID (Entrez)	6622

Novus Biologicals™ Recombinant Human XRCC1 GST (N-Term) Protein

Recombinant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Gensymbol	XRCC1
Förvaringskrav	Store at -80°C. Avoid freeze-thaw cycles.
Gene Alias	DNA repair protein XRCC1, RCC, X-ray repair complementing defective repair in Chinese hamster cells 1, X-ray repair cross-complementing protein 1, X-ray-repair, complementing defective, repair in Chinese hamster
Molekylvikt (g/mol)	MolecularWeight-theroretical: 95.26 kDa
Formulering	50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Forskningskategori	Apoptosis, Base Excision Repair, Cancer, DNA Repair, Homologous Recombination, Tumor Suppressors
För användning med (applikation)	Western Blot,ELISA,Protein Array,Immunoaffinity Purification
Protein	XRCC1
Renhet eller kvalitetsklass	>80% by SDS-PAGE and Coomassie blue staining
Gen-ID (Entrez)	7515

Novus Biologicals™ Recombinant Human UBE2R1/CDC34 Protein

Recombinant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Gensymbol	CDC34
Förvaringskrav	Store at -20°C. Avoid freeze/thaw cycles.
Gene Alias	cell division cycle 34, cell division cycle 34 homolog (S. cerevisiae), E2-CDC34, EC 6.3.2.19, UBC3, UBE2R1UBCH3, ubiquitin carrier protein, ubiquitin-conjugating enzyme E2 R1, Ubiquitin-conjugating enzyme E2-32 kDa complementing, Ubiquitin-conjugating enzyme E2-CDC34, Ubiquitin-protein ligase R1
Molekylvikt (g/mol)	MolecularWeight-theroretical: 26.7 kDa
Formulering	A 0.2 μm filtered concentrated solution in 50 mM HEPES, pH 7.0, 125 mM NaCl, 10 % Glycerol, 1 mM DTT.
Forskningskategori	Cancer, Cell Cycle and Replication, Core ESC Like Genes, Stem Cell Markers
För användning med (applikation)	SDS-PAGE
Protein	UBE2R1/CDC34
Endotoxinkoncentration	Less than 0.1 EU/μg of UBE2R1/CDC34 as determined by LAL method.
Renhet eller kvalitetsklass	>95%, by SDS-PAGE and HPLC
Gen-ID (Entrez)	997

Novus Biologicals™ Recombinant Mouse LIGHT/TNFSF14 Protein

Recombinant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Gensymbol	TNFSF14
Förvaringskrav	Store at -20°C to -70°C as supplied. After reconstitution, store at 2 to 8 C for 1 month and (at -20°C to -70°C for long term storage. Avoid repeated freeze/thaw cycles.)
Gene Alias	CD258, CD258 antigen, delta transmembrane LIGHT, Herpes virus entry mediator ligand, Herpesvirus entry mediator ligand, HVEM-L, HVEMLherpesvirus entry mediator-ligand, ligand for herpesvirus entry mediator, LIGHTherpesvirus entry mediator A, LTg, TR2, tumor necrosis factor (ligand) superfamily, member 14, tumor necrosis factor ligand superfamily member 14, tumor necrosis factor receptor-like 2, tumor necrosis factor superfamily member LIGHT
Rekonstitution	Recommended to centrifuge prior to opening. Reconstitute in 100 mM HAC to a concentration of 0.1-1.0 mg/mL Apportion stock solutions into working aliquots and store (at <-20°C.)
Molekylvikt (g/mol)	MolecularWeight-theroretical: 18.4 kDa
Formulering	Lyophilized from a 0.2 μm filtered concentrated solution in PBS, pH7.4.
Forskningskategori	Apoptosis
För användning med (applikation)	Western Blot,Bioactivity
Protein	LIGHT/TNFSF14
Endotoxinkoncentration	Less than 1 EU/μg of LIGHT/TNFSF14 as determined by LAL method.
Renhet eller kvalitetsklass	>95%, by SDS-PAGE and HPLC
Gen-ID (Entrez)	8740

Novus Biologicals™ Recombinant Human IFN-gamma Protein

Recombinant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Förvaringskrav	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Rekonstitution	Recommended to centrifuge prior to opening. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/mL. Apportion stock solutions into working aliquots and store at <-20°C.
Koncentration	LYOPH
Forskningskategori	Biologically Active Proteins, Cytokine Research, Immunology, Innate Immunity, Stem Cell Markers
Protein	IFN-gamma
Endotoxinkoncentration	Less than 1 EU/ug of IFN-gamma as determined by LAL method.
Gensymbol	IFNG
Gene Alias	IFG, IFI, IFN-gamma, Immune interferon, interferon gamma, interferon, gamma
Molekylvikt (g/mol)	16.9 kDa
Formulering	Lyophilized from a 0.2 um filtered concentrated solution in PBS, pH 7.4.
För användning med (applikation)	PAGE,Bioactivity
Renhet eller kvalitetsklass	>98% pure by SDS-PAGE and HPLC
Gen-ID (Entrez)	3458
Tillträdesnummer	P01579

Novus Biologicals™ Recombinant Protein G Cys (N-Term) Protein

Recombinant Protein

Prissättning och tillgänglighet

Rekombinanta proteiner

Novus Biologicals™ Recombinant Protein A Cys (C-Term) Protein

Recombinant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Förvaringskrav	Store at -20°C to -70°C as supplied. After reconstitution, store at 2°C to 8°C for 1 month and at -20°C to -70°C for long term storage. Avoid repeated freeze-thaw cycles.
Gene Alias	Immunoglobulin G binding protein A, SPA, Staphylococcal protein A
Rekonstitution	Reconstitute with distilled water or saline.
Molekylvikt (g/mol)	33.5 kDa
Formulering	Lyophilized from additive free solution.
Koncentration	LYOPH
Forskningskategori	Biologically Active Proteins, Epitope Tags
För användning med (applikation)	PAGE,Bioactivity
Protein	Protein A
Endotoxinkoncentration	Less than 0.1 EU/ug of Protein A as determined by LAL method.
Renhet eller kvalitetsklass	>98% pure by SDS-PAGE and HPLC
Gen-ID (Entrez)	3919448

Novus Biologicals™ Recombinant Human alpha-Synuclein Aggregate Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Källa	E.Coli
Rekombinant	Recombinant
Gensymbol	SNCA
Namn	Human alpha-Synuclein Aggregate Protein
Gene Alias	alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Reningsmetod	>95% pure by SDS-PAGE
Immunogen	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Regulatorisk status	RUO
Formulering	PBS
Produkttyp	Recombinant Protein
Korsreaktivitet	Human
För användning med (applikation)	In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Konjugera	Unconjugated
Gen-ID (Entrez)	6622

Novus Biologicals™ Mouse Brain Whole Tissue Lysate (Adult Whole Normal)

Prissättning och tillgänglighet

Vävnadslysater

Novus Biologicals™ Recombinant Bacteria Listeria monocytogenes p60 His Protein

Recombinant Protein

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Förvaringskrav	Store at 4C short term. Aliquot and Store at -20°C long term. Avoid freeze-thaw cycles.
Gene Alias	IAP p60 from Listeria Monocytogenes, Invasion-associated Protein p60, Invasion-associated Protein p60 from Listeria Monocytogenes, invasion-associated-protein, p60 protein
Molekylvikt (g/mol)	M.W. Theoretical: 50 kDa
Formulering	Liquid. 0.2um-filtered solution in PBS, pH 7.2
Koncentration	0.5 mg/ml
Forskningskategori	Immunology
För användning med (applikation)	SDS-PAGE
Protein	Listeria monocytogenes p60
Endotoxinkoncentration	<1 EU/μg purified protein (LAL test; Lonza).
Renhet eller kvalitetsklass	>90% SDS-PAGE
Tillträdesnummer	P21171

Novus Biologicals™ WDR5 Protein

Highly purified. Generating reliable and reproducible results.

Prissättning och tillgänglighet
Specifikationer

Rekombinanta proteiner

Förvaringskrav	Store at -80°C. Avoid freeze-thaw cycles.
Reningsmetod	SDS-PAGE
Molekylvikt (g/mol)	38.8kDa
Regulatorisk status	RUO
Formulering	Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol, 2mM DTT, 0.1M NaCl.
Koncentration	1mg/mL
För användning med (applikation)	SDS-PAGE
Konjugera	Unconjugated
Renhet eller kvalitetsklass	>95%
Vanligt namn	WDR5

FÖREG
1
2
3
4
5
6
...
3,347
NÄSTA

Filtrerade sökresultat

Begränsa resultat